Protein Info for CSW01_10230 in Vibrio cholerae E7946 ATCC 55056

Annotation: superoxide dismutase [Fe]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 82 (80 residues), 115.7 bits, E=1.1e-37
• PF02777: Sod_Fe_C
  • amino acids 89 to 191 (103 residues), 132.6 bits, E=5e-43

Best Hits

Swiss-Prot: 83% identical to SODF_PHOLE: Superoxide dismutase [Fe] (sodB) from Photobacterium leiognathi

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to vcj:VCD_002322)

MetaCyc: 77% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• superoxide radicals degradation (2/2 steps found)
• reactive oxygen species degradation (3/4 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (194 amino acids)

>CSW01_10230 superoxide dismutase [Fe] (Vibrio cholerae E7946 ATCC 55056)
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFENKSLEEIIKTS
TGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGAVAEAINAAFGSFADFKAKFTDSAINNFG
SSWTWLVKKADGTLAITNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAQNLAK