Protein Info for CSW01_10105 in Vibrio cholerae E7946 ATCC 55056

Annotation: 3-oxoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 1 to 316 (316 residues), 479.7 bits, see alignment E=1.9e-148 PF00108: Thiolase_N" amino acids 35 to 146 (112 residues), 35.4 bits, see alignment E=1.2e-12 PF08545: ACP_syn_III" amino acids 106 to 183 (78 residues), 109.1 bits, see alignment E=1.2e-35 PF08541: ACP_syn_III_C" amino acids 227 to 315 (89 residues), 117.7 bits, see alignment E=3.1e-38

Best Hits

Swiss-Prot: 100% identical to FABH1_VIBCH: 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 (fabH1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to vch:VC2023)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.41)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.3.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180, 2.3.1.41

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>CSW01_10105 3-oxoacyl-ACP synthase III (Vibrio cholerae E7946 ATCC 55056)
MYSKILGTGSYLPSQVRTNADLEKMVETSDEWIVARTGIRERRIAADNETVADMAFFAAQ
NAINMAGIDKHDIDMIIVATTSASHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALS
IADQHVKSGMCKHVLVIGADALSKTCDPTDRSTIILFGDGAGAVVVGASNEPGILSTHIH
ADGEFGDLLSLEVPVRGGDSDKWLHMAGNEVFKVAVTQLSKLVVDTLKANNMHKSELDWL
VPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIQRGQMLLL
EAFGGGFTWGSALVKF