Protein Info for CSW01_09955 in Vibrio cholerae E7946 ATCC 55056

Annotation: L-asparaginase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00519: L-asparaginase, type I
  • amino acids 4 to 336 (333 residues), 381 bits, E=2.3e-118
• PF00710: Asparaginase
  • amino acids 5 to 192 (188 residues), 210.5 bits, E=1.7e-66
• PF17763: Asparaginase_C
  • amino acids 213 to 325 (113 residues), 105.1 bits, E=2.2e-34

Best Hits

KEGG orthology group: K01424, L-asparaginase [EC: 3.5.1.1] (inferred from 100% identity to vch:VC1995)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
• L-asparagine degradation I (1/1 steps found)
• L-asparagine degradation III (mammalian) (2/3 steps found)
• N-(1-deoxy-D-fructos-1-yl)-L-asparagine degradation (2/5 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Cyanoamino acid metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.1

Protein Sequence (337 amino acids)

>CSW01_09955 L-asparaginase 1 (Vibrio cholerae E7946 ATCC 55056)
MARKHIYIAYTGGTIGMKKSDHGYVPVAGFMEKQLASMPEFHRPEMPLFTIHEYDPLMDS
SDMTPADWQLIADDIAANYDKYDGFVILHGTDTMAYTASALSFMFENLGKPVIVTGSQIP
LADLRSDGQANLLNALHVAANYPINEVTLFFNNRLMRGNRSRKSHADGFSAFSSPNLPPL
LEAGINIELSTNVKVDEKPSGEFKVNPITPQPIGVITMYPGISHEVIRNTLLQPVNAMIL
LTFGVGNAPQNPELLAQLKAASERGVIVVNLTQCLAGKVNMGGYATGCALADAGVISGYD
MTPEAALAKLHYLLSQNLSYEEVKAKMQQVLRGEMTL