Protein Info for CSW01_09925 in Vibrio cholerae E7946 ATCC 55056

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ
  • amino acids 5 to 225 (221 residues), 228.4 bits, E=4.7e-72
• PF00814: TsaD
  • amino acids 28 to 230 (203 residues), 118.3 bits, E=2.5e-38

Best Hits

Swiss-Prot: 72% identical to TSAB_VIBPA: tRNA threonylcarbamoyladenosine biosynthesis protein TsaB (tsaB) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 99% identity to vco:VC0395_A1574)

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (237 amino acids)

>CSW01_09925 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB (Vibrio cholerae E7946 ATCC 55056)
MSVKILALDTATERCSVALLVGNTVYSRSEIAPRDHTKKVLPMVDEVLKEAGVTLQELDA
LAFGRGPGSFTGVRIGIGIAQGLAFGADLPMIGISTLAAMAQAAYRLQGLTHVASAIDAR
MEEVYWGRYVRQEDGSWQVAEAECVIAPALLAQTLTQDDLTQDEQIWATAGTGWDAYPAL
ADLPLQLQTSEVLYPDAQDMAYLAQFELAQGNKVSVEQASPVYLRDTVAWKKLPGRE