Protein Info for CSW01_09860 in Vibrio cholerae E7946 ATCC 55056

Annotation: 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 TIGR00173: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase" amino acids 12 to 443 (432 residues), 462.1 bits, see alignment E=1.2e-142 PF02776: TPP_enzyme_N" amino acids 14 to 122 (109 residues), 72.5 bits, see alignment E=3.8e-24 PF16582: TPP_enzyme_M_2" amino acids 189 to 402 (214 residues), 158.2 bits, see alignment E=3.9e-50 PF02775: TPP_enzyme_C" amino acids 419 to 549 (131 residues), 27.1 bits, see alignment E=5e-10

Best Hits

Swiss-Prot: 100% identical to MEND_VIBCM: 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (menD) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K02551, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC: 2.2.1.9] (inferred from 100% identity to vco:VC0395_A1561)

Predicted SEED Role

"2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (EC 2.2.1.9)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 2.2.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>CSW01_09860 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylate synthase (Vibrio cholerae E7946 ATCC 55056)
MNRDQALLNRLWSRVLLEELSRLGVTQVCVAPGSRSTPLTLEANANTAFTLHTHYDERGL
GFMALGLAKASQQPVAVIVTSGTAVANLLPAIAESKLTGERLVVLTADRPLELVGCGANQ
AIVQSGIFSSHVTASLELPSPAIHHPLSWLLTSIDEVMARQALLGGSVHINCPFPEPLYS
AGDEAIYQPYLQPVQRWREQARPYTQVHQGLVQSVPAAIDGLLTKGVVIVGSLSLQEAQA
AKRFAKAMGWPLLCDPQSGISSQWAHFDLWLQHPKAREQLNQAQCVVQFGSRIVSKRLLQ
WLEAWCATGLGEYHYIAPHSARNNPWHAMQQQWVCEISHWVDAVLSKRLAGQHTQQGWAD
ELTHYAQSVRQLAQLHFSSSSLSEVALALDLTERATQADLFLGNSLIVRLVDIFSALDGR
EVFSNRGASGIDGLVATASGVQRARQKPLLMLLGDTSLLYDLNSLALMRNPAQPTVIVVT
NNDGGAIFDLLPVPSEQREALYQMPHGMDFAHAASQFGLAYCAAQTLEHYQTLVEEHFAH
GAGTLLIEVKTPPQQASMHIKQLTSQLHAL