Protein Info for CSW01_09820 in Vibrio cholerae E7946 ATCC 55056

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 373 to 399 (27 residues), see Phobius details amino acids 406 to 437 (32 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 317 (297 residues), 52.6 bits, see alignment E=5.4e-18 PF05977: MFS_3" amino acids 66 to 308 (243 residues), 31.7 bits, see alignment E=8.9e-12 PF01553: Acyltransferase" amino acids 443 to 569 (127 residues), 95.5 bits, see alignment E=3.6e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A1552)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (626 amino acids)

>CSW01_09820 MFS transporter (Vibrio cholerae E7946 ATCC 55056)
MNKMANPTTALLTERRFLPYFITQFLGAFNDNIFKNVLLLFVAFAGPQALPISSNLFINL
AAGLFILPFFLFSATAGVLADKLEKSRYIRWVKLLEIAIMLCGAIGFITQSYGISLFLLF
LMGTQSAFFGPVKYALLPQQLKSEELVPGNALVETGTFLAILLGTLGAGLIASADNAHYF
AAAAVVIFAVLGYLSSRAIPLAPASAPHLEFRWQPITQTKQTLRIAKRDRAIFQSIMAIS
WFWFLGAGYLTQFPNFTKLHLNGNEAAVSFLLALFSVGIAVGSLACDKLSGHRIEVGIVP
LGSVGISFFGYLMATSIPADLPIFSTFADFVTYSALWPLFAYLLLIGVFGGVFIVPLYAM
LQQRAKVTERAQVIAALNIYNSLFMVGSAALGIVCLSVLEMSIPQLFALLAVLNVLVALY
IFLQVPIFAVRFLVWILTHTLYRVRHKNLHHIPEQGGALLVCNHVSYMDALLLSAVCPRL
IHFVMEEEYANLPLLKRFLKRAGVIPISANNRASLRRAFADIEHSLNEGNLVCIFPEGRL
TADGEMNPFMRGLDLILHRSPVPVVPLALKGLWGSYFSRYKGRACQGVPRRFRSQLEIEA
GMPVAPEQANSAVMHEKVAQLRGDWR