Protein Info for CSW01_09795 in Vibrio cholerae E7946 ATCC 55056

Annotation: cell division topological specificity factor MinE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01215: cell division topological specificity factor MinE
  • amino acids 1 to 84 (84 residues), 116.1 bits, E=2.7e-38
• PF03776: MinE
  • amino acids 14 to 83 (70 residues), 79.8 bits, E=5.9e-27

Best Hits

Swiss-Prot: 100% identical to MINE_VIBCH: Cell division topological specificity factor (minE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03608, cell division topological specificity factor (inferred from 100% identity to vcj:VCD_002405)

Predicted SEED Role

"Cell division topological specificity factor MinE" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Protein Sequence (87 amino acids)

>CSW01_09795 cell division topological specificity factor MinE (Vibrio cholerae E7946 ATCC 55056)
MSLLEFFRPQKKTSASVAKERLQIIVAERRSQNDPAPSYLPQLKEDILKVIAKYVAIDPS
MVELSFEHKGDDISVLELNVKLPDDEK