Protein Info for CSW01_09645 in Vibrio cholerae E7946 ATCC 55056

Annotation: C4-dicarboxylate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details PF04290: DctQ" amino acids 40 to 192 (153 residues), 88.8 bits, see alignment E=1.5e-29

Best Hits

Swiss-Prot: 100% identical to DCTQ_VIBCH: C4-dicarboxylate TRAP transporter small permease protein DctQ (dctQ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 100% identity to vcm:VCM66_1852)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>CSW01_09645 C4-dicarboxylate ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MSVRHTIRAMYHMEQSWFSRVGQFTDSIEEFLIAFFMGAMTLLTFANVIMRYLFNDNILW
ALEGTVFMFAWMVLVGASFGVKRHFHIGVDVLINIAPARLRKLYALVAVACCLAFSILLL
IGSWNYWHPFITERAWYETDDIPMPDMLQFLADWVNEGERYEKLPRFIPYAALPIGMALL
TFRFLQIAWQIITGKLDRMIAGHEAEEDLEALKAELSEAGEAMMPKTQGKEK