Protein Info for CSW01_09640 in Vibrio cholerae E7946 ATCC 55056

Annotation: C4-dicarboxylate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 7 to 34 (28 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 82 to 107 (26 residues), see Phobius details amino acids 113 to 129 (17 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 241 to 257 (17 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 355 to 373 (19 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details PF06808: DctM" amino acids 7 to 437 (431 residues), 396.9 bits, see alignment E=5.1e-123 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 260 (244 residues), 287.6 bits, see alignment E=7.2e-90

Best Hits

Swiss-Prot: 100% identical to DCTM_VIBCH: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 100% identity to vcj:VCD_002436)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>CSW01_09640 C4-dicarboxylate ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MAVALLFILVIGMMIVGVPIAISLGLSSILFLLWHSDASLASVAQTLFNAFAGHYTLLAI
PFFILASTFMSTGGVAKRIIRFAIAMVGWFRGGLAIASVVACMMFAALSGSSPATVVAIG
SIVIAGMVKNGYSKEFAAGVICNAGTLGILIPPSIVMVVYSAATNVSVGRMFLGGVVPGL
LAGLMLIIAIYITARIKNLPKQPFVGWKEALKAAKEASWGLLLVVIILGGIYGGIFTPTE
AAAVAAVYSFFIANFIYRDMGPFADKTNTKPVLVKVVETFVHKDTKATLYDAGKLTIMLM
FIIANALILKHVLTEERIPQMITESMLSAGLGPITFLIVVNLILLVGGQFMEPSGLLVIV
APLVFPIAIALGIDPIHLGIMMVVNMEIGMITPPVGLNLFVTSGVAKMSMMNVVKAALPW
VGVMFLFLIIVTYVPWVSTWLPTLLMGPEIITR