Protein Info for CSW01_09630 in Vibrio cholerae E7946 ATCC 55056

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 162 to 173 (12 residues), see Phobius details amino acids 287 to 312 (26 residues), see Phobius details PF00512: HisKA" amino acids 374 to 438 (65 residues), 44.6 bits, see alignment E=1.2e-15 PF02518: HATPase_c" amino acids 486 to 590 (105 residues), 83.4 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 100% identity to vco:VC0395_A1515)

Predicted SEED Role

"Signal transduction histidine kinase regulating C4-dicarboxylate transport system"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>CSW01_09630 sensor histidine kinase (Vibrio cholerae E7946 ATCC 55056)
MPSIRRLSLMLWVMFIVLVSMSTHLYWRFQYQALLNEHQSQLDRFSSHIVATLDKYAHIP
HLISKDKELVDALLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSNWNLDR
SFIGRNFAWRPYFYLSIAGQKSQYFALGSTSGQRGYYYAYPVIYAAEILGVIVVKMDLSA
IEQGWQSKSSYFVATDDHQVVFMSSQPAWLFHSVADLSPAQLNDIRQSQQYLDSPIPSLG
WQGDLQAEQSEWRKPEKHWLQDDYIVSSRPLPELALTIRVLSPKIELFWSAFGLVIILCM
LFAIVYLGFQLWHHRQLRQRQIEQLQQETKQKLEFEVMERTAKLHAEIAERIKTEHALRQ
TQDELIQAAKLAVLGQMSASISHELNNPLAAIRSFADNGRRFLATNKPERAEENLSRISA
LTERMAKISEQLKSFARKSTSNEQQDVQLYPLILSAKELMTGQFKAQMTLLELCDLETPV
WVRVNPIQLEQVLINLLTNALQALEGQAERVVQIRLQTSEQQIALFVDDNGPGVGIETLP
HLFEPFHTTKKNGLGLGLSISQQILHSMQGTLSVATSPLGGARFTITLPRFTPLNMD