Protein Info for CSW01_09435 in Vibrio cholerae E7946 ATCC 55056

Annotation: lipoprotein-releasing system transmembrane subunit LolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 348 to 366 (19 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 8 to 406 (399 residues), 437.5 bits, see alignment E=2.4e-135 PF12704: MacB_PCD" amino acids 33 to 214 (182 residues), 45.7 bits, see alignment E=1e-15 PF02687: FtsX" amino acids 274 to 399 (126 residues), 53.5 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to vcj:VCD_002477)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>CSW01_09435 lipoprotein-releasing system transmembrane subunit LolC (Vibrio cholerae E7946 ATCC 55056)
MVGFMFHPISAFIGLRYLRGRSGDRFSRFVSYMSTAGITIGVMSLVTVLSVMNGFEAQLK
SRILGVLPQAVVTEAAGKTTLSATPPDFVTALSTQRPPEPLVRSDAVVQSASQLAAGLLI
GIEPQQNDPIEQHLIAGRVTALQAGEYQLFLGHLLARSLNVTVGDKVRLMVTEASQFTPL
GRLPSQRNFTVAGIFNTGSDVDGQLMVTHLRDAAKLLRYDAQTISGWRLFFDDPFVVSQL
AEQPLPQDWQWSDWREQRGELFQAVRMEKNMMGLMLGLIVGVAAFNIISALIMVVMEKQA
EVAILKTQGMQSQHVLAIFMVQGASSGVIGALVGGLLGVLLAANLNSLMEALGVALFSVG
GSLPVAIDPLQIVLVIVLAIVLSLLATLFPAYRASSVQPAEALRYE