Protein Info for CSW01_09425 in Vibrio cholerae E7946 ATCC 55056

Annotation: lipoprotein-releasing system transmembrane subunit LolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 318 to 345 (28 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details TIGR02213: lipoprotein releasing system, transmembrane protein LolE" amino acids 4 to 414 (411 residues), 695.2 bits, see alignment E=2.6e-213 TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 5 to 413 (409 residues), 522.3 bits, see alignment E=8.8e-161 PF12704: MacB_PCD" amino acids 30 to 241 (212 residues), 61.1 bits, see alignment E=1.9e-20 PF02687: FtsX" amino acids 274 to 407 (134 residues), 64.3 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 57% identical to LOLE_ECOLI: Lipoprotein-releasing system transmembrane protein LolE (lolE) from Escherichia coli (strain K12)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to vch:VC1882)

MetaCyc: 57% identical to lipoprotein release complex - inner membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolE"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>CSW01_09425 lipoprotein-releasing system transmembrane subunit LolE (Vibrio cholerae E7946 ATCC 55056)
MFSSLALFIGGRFSRAKQRNKMVSFISLSSTIGIAVGVAVIIIGLSAMNGFERELQTRVL
SVIPHGEFEGVRGPVERWPDLMAQAARHPQIVAAAPYVKITALAESGTQLKAIEVRGVDP
QREQAVSRLSQFITAQAWQDFRPGQQQVILGQGVAEKLGVQVGDFITLMIPSANSGDKVQ
APKRVRVKVSGLLALNGQIDHSLALLPLEDAQAYAHLGSGVTGISVKVADVLQATQIVRD
VGNQLNEYVYLHSWQQKYGFLYRDIQLVRTIMYLVMVLVIGVASFNIVSTLMMAVKDRAG
EIAILRTMGATDGLIKRIFVWQGVFSGVLGSVVGSVLGMVVAFNLTPLIKGLEHLIGHQF
LSGDIYFVDFLPSQVEWADVVLVSGTAIVLSLLATWYPARRASRLNPAQVLSSK