Protein Info for CSW01_09405 in Vibrio cholerae E7946 ATCC 55056

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 19 to 324 (306 residues), 399.9 bits, E=4.3e-124
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 24 to 326 (303 residues), 322.2 bits, E=1.7e-100

Best Hits

Swiss-Prot: 100% identical to LPXK_VIBCH: Tetraacyldisaccharide 4'-kinase (lpxK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to vco:VC0395_A1468)

MetaCyc: 100% identical to tetraacyldisaccharide 4'-kinase (Vibrio cholerae O1 biovar El Tor str. N16961)
Tetraacyldisaccharide 4'-kinase. [EC: 2.7.1.130]

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (8/9 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (12/17 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (4/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (12/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Protein Sequence (336 amino acids)

>CSW01_09405 tetraacyldisaccharide 4'-kinase (Vibrio cholerae E7946 ATCC 55056)
MVIEKIWFHRHPLGYLLWPLLWPFSVLFGVISRSRRKAYQTGDKPSYRAPLPVVVVGNIT
AGGNGKTPVVVWLVETLQNLGYRPGVVSRGYGAKAPSYPLVVNEQTPAQHCGDEPKLIFQ
RTKAPVAVDPVRSQAVKALLEHGVNVIVTDDGLQHYALQRDIEIAVVDGVRRFGNQELIP
LGPLREPVSRLDEVDFIITNGGVAKANEIAMRLQPTDAVNLKTGERCAVSKLTRLCAMAG
IGHPSRFFNTLRELNADLVHCQGFADHQAFDAAQLNQLAQQGAHLIMTEKDAVKCAEFAQ
PNWWYLPVSAQFAPEAEQRIVDKIKEVMEPYGSPSA