Protein Info for CSW01_09325 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 15 to 39 (25 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 73 (64 residues), 56.6 bits, see alignment E=1.5e-19 PF00528: BPD_transp_1" amino acids 33 to 241 (209 residues), 82.7 bits, see alignment E=1.5e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to vco:VC0395_A1453)

Predicted SEED Role

"Arginine/ornithine ABC transporter, permease protein AotQ" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>CSW01_09325 ABC transporter (Vibrio cholerae E7946 ATCC 55056)
MLDLQGYEASILKGALLTIEVAVLSLLLAMLLGMLGALAKMAPYRWARAIATLYTTIIRG
IPDLVLMMLIFFGGQILLNNGLSWFNEFINQWLTARDPNHEWVAYLPDYVDISPFVAGVL
TIGFIFGAYMAETFRGAILAVDKGELEAAKAYGMSAAMSFRRILLPQMIRHAIPGFGNNW
LVLLKTTALVSIIGLEDMVRISSLAAGSTKMPFTFYMAVAIIFLFFTSVSTGLLKLLERK
FSIHTR