Protein Info for CSW01_09145 in Vibrio cholerae E7946 ATCC 55056

Annotation: PTS fructose transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00381: PTS-HPr
  • amino acids 19 to 85 (67 residues), 25.8 bits, E=8.7e-10
• PF00359: PTS_EIIA_2
  • amino acids 144 to 243 (100 residues), 50.4 bits, E=2.4e-17

Best Hits

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 100% identity to vco:VC0395_A1420)

Predicted SEED Role

"Putative PTS system, nitrogen regulatory IIA component"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (259 amino acids)

>CSW01_09145 PTS fructose transporter subunit IIA (Vibrio cholerae E7946 ATCC 55056)
MMHEFQVTFLVNDVNASVHVAQPLSRVARKFKSTLHIINITRNRSAELTKSLAVLQVGLQ
EGDLCQITAIGIDAELACFVIKDMLSAHYTVVGSKINYEFSSLLAERLPQICPPSEVKWH
YAKAHTELTKFECLKGLAQLIYPVSPDELILAFIKREERSSTCVAPGIAIPHVMFADIEH
IAVAVIKNDEAMDWASQMGEVHLAIALVMPSKPNRDQIITATNLTRNLLCDQMVERLLLT
RSGVDLQALLMYAMSRLLN