Protein Info for CSW01_09140 in Vibrio cholerae E7946 ATCC 55056

Annotation: PTS fructose transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02302: PTS_IIB
  • amino acids 4 to 94 (91 residues), 66.1 bits, E=1.9e-22
• TIGR00829: PTS system, Fru family, IIB component
  • amino acids 4 to 87 (84 residues), 105 bits, E=9.7e-35

Best Hits

Swiss-Prot: 48% identical to PTFB2_ECOL6: PTS system fructose-like EIIB component 2 (frwB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] (inferred from 100% identity to vcj:VCD_002551)

MetaCyc: 48% identical to putative PTS enzyme IIB component FrwB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (99 amino acids)

>CSW01_09140 PTS fructose transporter subunit IIB (Vibrio cholerae E7946 ATCC 55056)
MKIVAVTACPTGIAHTYMAADALTKAAPKYNVQIKVETQGAMGIENPLTPYDLSHADKVL
IVSDIDIEQPARFEGMKVVKLSIEEVLLNVDKVFLVHCR