Protein Info for CSW01_08945 in Vibrio cholerae E7946 ATCC 55056

Annotation: N-acetylglucosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR00221: N-acetylglucosamine-6-phosphate deacetylase" amino acids 5 to 369 (365 residues), 282.7 bits, see alignment E=2.2e-88 PF01979: Amidohydro_1" amino acids 53 to 366 (314 residues), 47.8 bits, see alignment E=6.4e-17

Best Hits

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 100% identity to vch:VC1783)

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.25

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>CSW01_08945 N-acetylglucosamine-6-phosphate deacetylase (Vibrio cholerae E7946 ATCC 55056)
MALKAISATRLFDGIQYYENAAMVWEGSHIHSIVPIESLTEDIEHQHFDGALIAPGFIDL
QVNGGGDVMFNNDMTLAGIDSICRAHRTHGTAYLLPTLISATPEHINRALDAIQSAIENQ
VSGVLGIHLEGPWLNPEKKGAHNPDLFYSPTPEQLSQFHWPTKGKVLVTVAAENLSIDSL
KWLKDHHVTLSCGHSNATTAQLTTEKLALIDGFTHLFNAMSPFESREPGVVGTALNTDHA
WCSVITDGIHVHPQSFLLAKRIKPKDKLLIVTDAMASLGSVTSQFELDGETIRVIDNKLI
NSRGNLAGAHIGMDESVANVIRWGIAEDEALKMASSYPAQAIQCDDLGQLKPNYRAAATV
LNSKYESLAVVSEGVLYN