Protein Info for CSW01_08920 in Vibrio cholerae E7946 ATCC 55056

Annotation: C4-dicarboxylate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details PF04290: DctQ" amino acids 26 to 153 (128 residues), 94.3 bits, see alignment E=2.9e-31

Best Hits

Swiss-Prot: 100% identical to SIAQ_VIBCH: Sialic acid TRAP transporter small permease protein SiaQ (siaQ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1716)

Predicted SEED Role

"TRAP-type transport system, small permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>CSW01_08920 C4-dicarboxylate ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MELKMLRKIINNIEEIITVPLMAALLAVLTWQIGTRWLLNDPSLWSEELARLLFMYMCLV
GCAIAIKRSSHVNITFFSDKLPEKARLSLVLSLEIAVLVSIGAIIVLGYQHAQRNAFFEL
ITLGISSSWMNYSLPVGGVFMVFRQLEKIFNLMKLLLGVSSSASLIDQQVTER