Protein Info for CSW01_08800 in Vibrio cholerae E7946 ATCC 55056

Annotation: paraquat-inducible protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF02470: MlaD" amino acids 48 to 139 (92 residues), 48.3 bits, see alignment E=4.8e-17 amino acids 163 to 222 (60 residues), 35 bits, see alignment 6.9e-13 amino acids 292 to 395 (104 residues), 43.5 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 100% identity to vcm:VCM66_1693)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>CSW01_08800 paraquat-inducible protein B (Vibrio cholerae E7946 ATCC 55056)
MRKLSMSDEPQVNAEITAQKQLSAIWIIPILALAMGLWMLFQYVNSTGPKITLILPTADG
LEVGKTQIKALNVNVGVITEIKLSEDYDHIVATAQMSKDADRMLREDTLFWVVKPRIGRE
GISGLDTLLSGAYIQLQPGTASSAQDHFKVMDLPPIAPPDAKGLRLVLTNKEAGKLNVGD
PVMYEGFTVGRVESAQFDVESKKAQYQLFIFAPYDKLVNTRSFFWLNSGINLQLNAEGLE
FSLGSIESLLKGGVTFGQLQEEDSGQPITQQLTEFRLFDDVKQIREGMFDDYIEFVMMFD
ESVRGLKPSAPVEYRGLRIGTVSKVPLRTRTSNIDISTNRIPVLVRIELGRLYDNFNKAD
LPALKSRMQQEFFKGLKASLKTGNLVTGALYIDTDYYPEEKIDGLKHFDGYPLFPTKQGG
FAEVQKQVTELLRKLNGLPMDDTLASLNSTLKTSEALLASAERILKKQETQNLPADIQAS
LKQLETTLGGFGPESTVYRELETTLRELNQVMAEFKPVLRTINEKPNALIFGESNTADPI
PAKGKQE