Protein Info for CSW01_08660 in Vibrio cholerae E7946 ATCC 55056

Annotation: PurR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00356: LacI" amino acids 3 to 48 (46 residues), 71 bits, see alignment 1.2e-23 PF00532: Peripla_BP_1" amino acids 60 to 317 (258 residues), 113.4 bits, see alignment E=2.9e-36 PF13407: Peripla_BP_4" amino acids 62 to 277 (216 residues), 73.5 bits, see alignment E=4.2e-24 PF13377: Peripla_BP_3" amino acids 170 to 330 (161 residues), 137 bits, see alignment E=1.4e-43

Best Hits

Swiss-Prot: 100% identical to PURR_VIBCM: HTH-type transcriptional repressor PurR (purR) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K03604, LacI family transcriptional regulator, purine nucleotide synthesis repressor (inferred from 100% identity to vco:VC0395_A1324)

MetaCyc: 51% identical to DNA-binding transcriptional repressor PurR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Purine nucleotide synthesis repressor" in subsystem Purine nucleotide synthesis regulator

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>CSW01_08660 PurR family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MATIKDVARLAGVSTTTVSHVINKTRFVAETTQEKVMEAVKQLNYAPSAVARSLKCNTTR
TIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGIL
VMCSDLTQELQDMLDAHKDIPKVVMDWGPETSHADKIIDNSEEGGYLATKYLTDRGHTEI
ACLSGHFVKAACQERIQGFRRAMAEAKLTVNEDWILEGNFECDTAVLAADKIIAMDKRPT
AVFCFNDTMALGLMSRLQQKGIRIPEDMSVIGYDNIELAEYFSPPLTTVHQPKRRVGKNA
FEILLERIKDKEHERRIFEMHPEIVERDTVKDLTKS