Protein Info for CSW01_08590 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 69 (27 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details PF27206: HI_1241" amino acids 5 to 212 (208 residues), 68.9 bits, see alignment E=2.6e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1648)

Predicted SEED Role

"FIG00919661: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>CSW01_08590 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MLYSLISVFAPMLLGAQIILTLVLVKGEICPGQRGRIHKVLPALAVLWLAVASIKIEAFL
VVFALFYFYSQVQTKKTREEGPLWVMYLANGLALAYVGILISEAPAWPASLTIFAAIFLL
GAMLGHLLLTLARSRLQAFHRILPVVGIVSAMLTALCLLPYVSGLNDEQLQTLLMPIVMS
FGLLITGIVAWCWHLISGKTVNKWQLLLAGLLVLASATGFHGLYQMPL