Protein Info for CSW01_08500 in Vibrio cholerae E7946 ATCC 55056

Annotation: alpha-galactosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02065: Melibiase
  • amino acids 154 to 338 (185 residues), 61.1 bits, E=1.5e-20
• PF05691: Raffinose_syn
  • amino acids 183 to 226 (44 residues), 23.9 bits, 1.4e-09
• PF01055: Glyco_hydro_31_2nd
  • amino acids 186 to 337 (152 residues), 36.2 bits, E=6.7e-13

Best Hits

KEGG orthology group: K07407, alpha-galactosidase [EC: 3.2.1.22] (inferred from 100% identity to vch:VC1690)

Predicted SEED Role

"Alpha-1,6-galactosidase, putative"

MetaCyc Pathways

• stachyose degradation (6/7 steps found)
• melibiose degradation (1/1 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - globo series
• Sphingolipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.22

Protein Sequence (361 amino acids)

>CSW01_08500 alpha-galactosidase (Vibrio cholerae E7946 ATCC 55056)
MQQADIELEIAGNELFARYIGLHNRPFERRYPLFSTLLDVESDARLVGDGFQMLSQASGT
LSHIQEVGRCPDNNLSYRIYPHDAPKRFYNTLMIEAAGRYLLFGFTSCQRFAGFFEVHRH
PQHWVLSAFIDGEETRPQDWITNQLESVICLEGESMSELYQAYAEAISRQHPPRPHLKDP
APMGWCSWYAYYAEVTEQDIKENVAILAERHPELEWVLLDDGYQAFMGDWLTPSQKFPSG
IEQVIADIRAQGKKPAIWLAPFIAEADSAVFRQHPDWFVKNAAGQPLKAEEITYGGWRCT
PWYVLDCSHPDVQEHLTQVVKTLREEWGVELFKLDANYWGTLQGQRFQSGVTGVEAYRMG
M