Protein Info for CSW01_08450 in Vibrio cholerae E7946 ATCC 55056

Annotation: antimicrobial peptide ABC transporter permease SapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 70 to 97 (28 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 149 to 165 (17 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 283 to 310 (28 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 314 (224 residues), 135.1 bits, see alignment E=1.2e-43

Best Hits

Swiss-Prot: 50% identical to SAPB_ECOLI: Putrescine export system permease protein SapB (sapB) from Escherichia coli (strain K12)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to vco:VC0395_A1286)

MetaCyc: 50% identical to putrescine ABC exporter membrane subunit SapB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system permease protein SapB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>CSW01_08450 antimicrobial peptide ABC transporter permease SapB (Vibrio cholerae E7946 ATCC 55056)
MFVYTVRKFNLFIITLLILTMVGYSLARFDPHSPWTLIGFWQGWSSYLVQLMEFNFGLNK
NGVPILHELLVVFPATIELCTIAFILSLLVGIPIGTLAGMRQGKWLDTIISFISMSGYSA
PIFWLALMMIMAFSLHFPVFPVAGRYDLLYQIDHVTGFALIDAFLSQSPYRSQALQSVIE
HLTLPCLVLALAPTTQVIGQMRASVAEVMNQNYIRAAKIKGLSNYQIVTQHVLRNAIPPM
IPKFGVQLSSMLTLAIITESIFNWPGIGRWLLDALANRDFMSIQAGVIVVGTLVLTANIL
SDLIGAAANPLVRKEWYVKR