Protein Info for CSW01_08440 in Vibrio cholerae E7946 ATCC 55056

Annotation: phage shock protein operon transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR02974: psp operon transcriptional activator" amino acids 5 to 325 (321 residues), 540.8 bits, see alignment E=6.7e-167 PF00158: Sigma54_activat" amino acids 6 to 168 (163 residues), 201.5 bits, see alignment E=2.8e-63 PF14532: Sigma54_activ_2" amino acids 6 to 176 (171 residues), 62.9 bits, see alignment E=1.4e-20 PF07728: AAA_5" amino acids 28 to 148 (121 residues), 38.9 bits, see alignment E=2.9e-13 PF07724: AAA_2" amino acids 29 to 155 (127 residues), 36.4 bits, see alignment E=2e-12 PF01078: Mg_chelatase" amino acids 29 to 147 (119 residues), 23.6 bits, see alignment E=1.1e-08 PF25601: AAA_lid_14" amino acids 177 to 238 (62 residues), 68.7 bits, see alignment E=1.2e-22 PF02954: HTH_8" amino acids 291 to 325 (35 residues), 28 bits, see alignment 5.3e-10

Best Hits

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 100% identity to vcj:VCD_002698)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>CSW01_08440 phage shock protein operon transcriptional activator (Vibrio cholerae E7946 ATCC 55056)
MQQSLLGESPAFLAVLDKVSRLAPIDRPVLVIGERGTGKELIAQRLHYLSKRWEQPLVSL
NCSTLSEGLIDSELFGHESGSFTGAKGRHQGRFERAEGGTLFLDELATAPLSVQEKLLRV
IEYGQYERVGGNQVLNANVRLVCATNANLPQMAQQGTFRADLLDRLAFDVIHLPALRHRP
EDIALLAEHFAIRMCRELQLPLFVGFSPNALHQLQAYSWPGNVRELKNVVERAVYQHGLN
SQPIDQLVFNPFQSSDIVTDESEQVDVRHTTRTDFHLPLDYKAWQQQCDIELLQAALTQA
KFNQKHAAQLLGLSYHQFRGMMRKYPQMNSENASPHVE