Protein Info for CSW01_08380 in Vibrio cholerae E7946 ATCC 55056

Annotation: TIGR01621 family pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR01621: pseudouridine synthase Rlu family protein, TIGR01621" amino acids 1 to 220 (220 residues), 403.6 bits, see alignment E=7.6e-126 PF00849: PseudoU_synth_2" amino acids 10 to 153 (144 residues), 97.9 bits, see alignment E=3.5e-32

Best Hits

Swiss-Prot: 47% identical to Y042_HAEIN: Uncharacterized RNA pseudouridine synthase HI_0042 (HI_0042) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06177, ribosomal large subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 100% identity to vcm:VCM66_1608)

Predicted SEED Role

"Pseudouridine synthase"

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.12

Use Curated BLAST to search for 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>CSW01_08380 TIGR01621 family pseudouridine synthase (Vibrio cholerae E7946 ATCC 55056)
MFDILFTHPDFLLINKHPNVSVHKDDGDTMLLQEVATQTGDGQLYLVHRLDKMTSGILLL
ARNATAASELSQGFAKRKVEKFYLAIGSKKPKKKQGLICGDMERSRRSSWKLVNSQENPA
ITQFFSAAAATGERLFLCKPHTGKTHQIRVALKSIGSAIVGDPIYNTADESDRGYLHAFA
LRFTYQGEVYQWLCDPRQFSHLGQKWHEEAVNQGIENWLSPWDLPWPALKVVVKE