Protein Info for CSW01_08365 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 99 to 126 (28 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 383 to 408 (26 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details amino acids 467 to 488 (22 residues), see Phobius details amino acids 518 to 538 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 367 to 538 (172 residues), 35.4 bits, see alignment E=4.7e-13

Best Hits

KEGG orthology group: K05778, putative thiamine transport system permease protein (inferred from 100% identity to vch:VC1665)

Predicted SEED Role

"ABC transporter, permease protein YnjC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>CSW01_08365 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MLRTAYWGFILLCVAPILPGLAGVLISASGYLPVLGHHHVSWQGFSQVWQWQGVEYALLL
SVTSTLFSTYLALLMSFAILQRFWFHPRWKRIENSLSILLALPHVAFAIGFASLFASTGW
LARLLYYGFELRDNSHEVTWLVHDPYAIGLTIALALKEVPFILLISLPILQQLNLTKMKM
LSASLGYSEPQMWWKIVFPQWLRKIRFTLFAVAAYAISVVDFSLVLGPTTPPTFSVLVWQ
WFNEPDLNLLPRAASGAVVLLLLASIVLVAIVALEWLFTRGYRAWQSSGRSHFPLPHKSI
LTLLFTISGAMIPLTLIWSLAQRWRFPDLFPTQWTGQFWYDEWPNVLHNMETSVLLALGS
GSLALLLGILAQEYRLHTQRAIPVYIIALPMLLPQLSLLFGIQVLTLLMASQAYTWWVVW
AHTFFAFPLVYLALSGPWQSYNSNFSKIARSLGKSEWQIFWKIKLPLLFPALLYAWAVGI
SVSLAQYLPTLMLGGGRLTTITTEAVALSSGYDRRVTAIYALCQALLPFVFFSIALLLGR
MQIHRYRAAQLTTVFHDIFSRKPRHP