Protein Info for CSW01_08325 in Vibrio cholerae E7946 ATCC 55056

Annotation: serine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 30 to 385 (356 residues), 47.2 bits, see alignment E=9.1e-17

Best Hits

KEGG orthology group: K03837, serine transporter (inferred from 100% identity to vcj:VCD_002721)

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>CSW01_08325 serine transporter (Vibrio cholerae E7946 ATCC 55056)
MKDSQEVTHFSAARSSKWTQHDTYWLLSLFGTAVGAGILFLPINIGLGGFWPLVLMAVLA
FPMTYLSHRGLARFVLSSRRPNADFTDVVEEHFGQNAGRLISLLYFLSIFPILLIYGVGL
TNTVDSFLVNQADMVSPPRALLSGALVFGLIAIMLSGEKIMLRAFAIMVYPLAAILALLS
LYLIPYWSMPSFDFPQTSDFLHTVWLAVPVVVFSFSHAAAISSFANIQRRHYGEQADQKS
EQILRHTSVVLILFVLLFVFSCVLALSPQALQEAKAQNISVLTYLANVTDNPFIATLGPL
VAFIAITSSFLGHFLGARESLSGLLTKNLGVSLRLAERLTIGFLFVTIWIAAILNPSILG
MMEALSGPVIAMILFIMPMIAVFKVPALREHQKRFSTFFVLLVGLLAVSALLYSLLR