Protein Info for CSW01_08195 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00005: ABC_tran" amino acids 21 to 167 (147 residues), 115.9 bits, see alignment E=2.1e-37

Best Hits

Swiss-Prot: 40% identical to LOLD_GEOSL: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to vch:VC1630)

Predicted SEED Role

"AttE component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>CSW01_08195 ABC transporter ATP-binding protein (Vibrio cholerae E7946 ATCC 55056)
MLQLIDLCKGYVDGDEFHPVLQGAELTLNQGDQLALMGESGSGKSTLLNLIAGLDSADSG
EIWFPGFPMHHTSEHHRTAFRRDNIGQIFQQYNLLPTLNIADNIRFCRQLKGLPEDAGLW
RQILSALDLMPLLGRYPEEVSGGQQQRAAIARALYMEPKILLADEPTGSLDERNAEAVMR
LLTTLTRQLNCALLLVTHSEKVAQHMDGCIRLQGGQLHVMARS