Protein Info for CSW01_08080 in Vibrio cholerae E7946 ATCC 55056

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details PF16576: HlyD_D23" amino acids 40 to 275 (236 residues), 40.7 bits, see alignment E=3.5e-14 PF13533: Biotin_lipoyl_2" amino acids 45 to 86 (42 residues), 44.5 bits, see alignment 2.1e-15 PF13437: HlyD_3" amino acids 206 to 283 (78 residues), 24.3 bits, see alignment E=9e-09

Best Hits

Swiss-Prot: 50% identical to AN36_HELPY: 36 kDa antigen (HP_1488) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to vco:VC0395_A1212)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>CSW01_08080 HlyD family secretion protein (Vibrio cholerae E7946 ATCC 55056)
MKTVKTTLMTLTAVAVVGWIGYRFYQAYQPEPVTLQGQIESQQYSISSKVPGRIDQVLVR
KGDQVEKGQLIFTLLSPEIDAKLEQAIAGQKAAGALAQEAENGAREQQIQAAKDQWLKAQ
AAAELAEKTYLRVNNLYNDGVVSEQKRDEAQTQWQAAKYTESAALQMYQLAKEGAREETK
QAALEKARMAAGAVAEVEAYAADTKIQSWFDGEVSQVLMHSGELAPQGFPVVTVVDTQDT
WAVFNVREDLLKHFTQGAQFTAYLPALNKSIEFKVTHVAVMGDFATWRSTDATQGFDLRT
FEVEARPVTPTEGLRMGMSVVVKL