Protein Info for CSW01_08030 in Vibrio cholerae E7946 ATCC 55056

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 88 (17 residues), see Phobius details amino acids 94 to 110 (17 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details PF20966: MASE6" amino acids 6 to 175 (170 residues), 192.3 bits, see alignment E=6.7e-61 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 178 to 335 (158 residues), 136.4 bits, see alignment E=3.9e-44 PF00990: GGDEF" amino acids 179 to 332 (154 residues), 124.7 bits, see alignment E=3.2e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_002777)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>CSW01_08030 sensor domain-containing diguanylate cyclase (Vibrio cholerae E7946 ATCC 55056)
MDARLFDNTQTLRASVLCGLSFFWALIAFLMALINFWSTRLVELASLELVCAFYSLYIYS
LAKRRIHTKQQVYLYLFILTGTTLFATYMKPLMMGVYIWSCFVPILFYIFTSARFAFVTS
CLFLIIQSNIIYWQLQQTGAALSWSVLLHLCFAYIGIWVVAHVYEDNRRKIENSLLYLAS
RDPLTGAHNRLSLTTSFQHFERFSDQTSLCLLVIDLDFFKSINDQFGHDTGDKVLIETTR
LFTQVVGDNNLYRIGGEEFCVTLFDQSLEQAGRVCEHLRAIVSQHLFAFREKRVQVTISI
GVCEYQAGDQLNDLLKFADMELYRAKKAGRNQVRLFRHGSTNPTMVNQQTENV