Protein Info for CSW01_08000 in Vibrio cholerae E7946 ATCC 55056

Annotation: galactokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR00131: galactokinase" amino acids 25 to 400 (376 residues), 486.4 bits, see alignment E=2.8e-150 PF10509: GalKase_gal_bdg" amino acids 30 to 78 (49 residues), 82.4 bits, see alignment 2e-27 PF00288: GHMP_kinases_N" amino acids 114 to 201 (88 residues), 73 bits, see alignment E=2.9e-24 PF08544: GHMP_kinases_C" amino acids 299 to 381 (83 residues), 51.2 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 100% identical to GAL1_VIBCH: Galactokinase (galK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00849, galactokinase [EC: 2.7.1.6] (inferred from 100% identity to vcj:VCD_002781)

MetaCyc: 64% identical to galactokinase (Escherichia coli K-12 substr. MG1655)
Galactokinase. [EC: 2.7.1.6]

Predicted SEED Role

"Galactokinase (EC 2.7.1.6)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>CSW01_08000 galactokinase (Vibrio cholerae E7946 ATCC 55056)
MSGAAPTPASLSPFKVRSPMSELIQNVTTTFAQLFGYDATHLVQAPGRVNLIGEHTDYND
GFVLPCAINYQTVVAAAKREDFLVRLVAVDYDNDTDEFDLREEIAFQPKKMWSNYIRGVI
KCLIERGFEFNGADIVVSGNVPQGAGLSSSAALEVVIGQTFKELYQLKISQAEIALNGQQ
AENQFVGCNCGIMDQMISAQGQANHAMLLDCRSLQTEAVAMPEQMAVVILNSNKKRGLVE
SEYNTRRQQCEAAAKTFGVKALRDVTLAQLTAKQAELDPVVAKRARHVITENERTLHAAQ
ALREGNMPRLGELMAASHASMRDDFEITVKEIDTLVEIVQSVIGDQGGVRMTGGGFGGCV
VALVHPKQVEAVQQAVAEHYEAATGLKASIYVCHATSGAGLVELA