Protein Info for CSW01_07970 in Vibrio cholerae E7946 ATCC 55056

Annotation: alpha-acetolactate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR01252: alpha-acetolactate decarboxylase" amino acids 30 to 260 (231 residues), 351.3 bits, see alignment E=1.1e-109 PF03306: AAL_decarboxy" amino acids 31 to 248 (218 residues), 278.6 bits, see alignment E=1.5e-87

Best Hits

Swiss-Prot: 100% identical to ALDC_VIBCH: Alpha-acetolactate decarboxylase (VC_1589) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01575, acetolactate decarboxylase [EC: 4.1.1.5] (inferred from 100% identity to vcm:VCM66_1529)

MetaCyc: 60% identical to alpha-acetolactate decarboxylase (Klebsiella aerogenes)
Acetolactate decarboxylase. [EC: 4.1.1.5]

Predicted SEED Role

"Alpha-acetolactate decarboxylase (EC 4.1.1.5)" in subsystem Acetoin, butanediol metabolism or Alpha-acetolactate operon (EC 4.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>CSW01_07970 alpha-acetolactate decarboxylase (Vibrio cholerae E7946 ATCC 55056)
MNPLLSAHCSCSQEIAQQFAHYQHISGEGEIYQTSLMSALIAGVYEGATTIAQLLEHGDF
GLGTFNELDGELIAFDRQVFQLRADGSAQPAHPEQQTPFAVFTFFKADIELPITERMTRE
QVHQLIDRLVPSDNLFCAIRIDGTFPSVQTRTVPKQQRPYRPMLEVVKQQPVFRFQQQHG
VIAGFRSPQYTTGINVPGYHEHFITQQRTGGGHIQDYIIRSGFLQIGRVSRLVVDTPVSR
DFLEANLTPNNIRTAIEAAEK