Protein Info for CSW01_07905 in Vibrio cholerae E7946 ATCC 55056

Annotation: DUF2127 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 20 to 35 (16 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details PF09900: DUF2127" amino acids 7 to 143 (137 residues), 146.8 bits, see alignment E=2.6e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1515)

Predicted SEED Role

"FIG01199896: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>CSW01_07905 DUF2127 domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MSNTHQGLKAVAILESAKGIVSLLLGLGLHHVAGDSLQLLLLDLLQHLHLNPASYWPEKL
LHQAGLFTHFNLNWVAAGALVYGAIRLIEAYGLWHNLLWTEWFALLSGAIYLPFEVYELF
THPGVFSMAALLINLVIVLYMYRIIRSKVPQR