Protein Info for CSW01_07825 in Vibrio cholerae E7946 ATCC 55056

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF00356: LacI" amino acids 12 to 57 (46 residues), 71.2 bits, see alignment 1e-23 PF00532: Peripla_BP_1" amino acids 69 to 279 (211 residues), 108.2 bits, see alignment E=1.1e-34 PF13407: Peripla_BP_4" amino acids 71 to 319 (249 residues), 82.9 bits, see alignment E=5.5e-27 PF13377: Peripla_BP_3" amino acids 179 to 339 (161 residues), 125.3 bits, see alignment E=5.3e-40

Best Hits

Swiss-Prot: 40% identical to ASCG_ECOLI: HTH-type transcriptional regulator AscG (ascG) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to vcj:VCD_002818)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>CSW01_07825 LacI family transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MRTQFEGLLMATINDVCKLAGVSKATVSRVLNETGQVKAQTREAVLAAMQQLGYQPNSLA
QALATNTTNSIGLVLPHFESSYFGSILFEAEQGAQKAGKKLLVMNSKNSEQGEKEAVATL
AAQRCDAILLYSRHLNEVQLLELQQQHPSPLVILNRRLHHPQLHSFGLDQTQIAQLAMQH
LLNLGHRQIACITSPLVSETGKIRYQVYQQALHEQGIELSSSLVIEGDNTLLGGYQAMQQ
LLQQGISMTAVFACNDDMALGAMRAMHEHGIHVPKQVSIIGIDNEPAAAFAIPSLSSVSL
PIGELTQQAISLAVEIANKKPQDAQHRLYQGSLIARESTIALKL