Protein Info for CSW01_07800 in Vibrio cholerae E7946 ATCC 55056

Annotation: sn-glycerol-3-phosphate import ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00005: ABC_tran" amino acids 40 to 181 (142 residues), 119 bits, see alignment E=2.5e-38 PF17912: OB_MalK" amino acids 255 to 299 (45 residues), 36.8 bits, see alignment 6.2e-13

Best Hits

Swiss-Prot: 100% identical to UGPC_VIBCH: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05816, sn-glycerol 3-phosphate transport system ATP-binding protein [EC: 3.6.3.20] (inferred from 100% identity to vch:VC1552)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>CSW01_07800 sn-glycerol-3-phosphate import ATP-binding protein UgpC (Vibrio cholerae E7946 ATCC 55056)
MKNNQNSNIHLLRSAKHAEPVMLDIKQLVKTYDNGHQAVKGVDLSIHQGEFIVLVGPSGC
GKSSILRSIAGLESITSGEIHLAGRRVDNEKPANRDIAMVFQNYALYPHMSVYDNLAYGL
KNRGVDKQTIAAKIAKVAKTLKIEEYLDRKPAKLSGGQRQRVAMGRAIVRDPQLFLFDEP
LSNLDAALRAHMRLEIKKLQRELGVTSVYVTHDQVEAMTLADRIVVVKQGEIEQVGTPAE
VYHQPASTFVASFIGSPAMNFLPASIKQGQLHIAGKHCYLPQFDAMSSENITLGIRPEHA
SLHPLTNAIELKLDIQVVEPLGPNQLVHGKIIGLESEQDFIAVTAEIPLDVHQTLPIWVA
LEQLHLFDQQGKRFVQSHRSCTQSSKVASTRQQ