Protein Info for CSW01_07795 in Vibrio cholerae E7946 ATCC 55056

Annotation: sn-glycerol-3-phosphate ABC transporter permease UgpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 184 to 209 (26 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 275 (187 residues), 58.7 bits, see alignment E=3.3e-20

Best Hits

Swiss-Prot: 50% identical to UGPE_AGRFC: sn-glycerol-3-phosphate transport system permease protein UgpE (ugpE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 99% identity to vco:VC0395_A1157)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>CSW01_07795 sn-glycerol-3-phosphate ABC transporter permease UgpE (Vibrio cholerae E7946 ATCC 55056)
MKSNRLSDHLILIAGALFMLVPLWLIFASSTHQPNTIVSEGLQWTLGDNLSAVYREAWNK
SLGFAGNVTAQTMIVNSMIMGLGFAIGKIVISMMAAYALVYFRLPYASAWFWLIFITLLL
PLEVRIIPSYEVVSNLGMLNSYTGLVLPLIASATATFFFRQFFKTIPDELLEAAQLDNAG
PIRFFIDILFPLSKTMMAAIFIIMFVVGWNQYLWPIMMTTDEQYNTIVMGIKQILNNINE
TSLPRYDYAFAMVILAMLPPVLVVVIFQRWFVKGLVESEK