Protein Info for CSW01_07540 in Vibrio cholerae E7946 ATCC 55056

Annotation: MCE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 879 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details PF02470: MlaD" amino acids 47 to 138 (92 residues), 52.9 bits, see alignment E=1.8e-18 amino acids 164 to 231 (68 residues), 38 bits, see alignment 8.1e-14 amino acids 284 to 375 (92 residues), 41.7 bits, see alignment E=5.5e-15 amino acids 400 to 461 (62 residues), 40.6 bits, see alignment 1.2e-14 amino acids 522 to 578 (57 residues), 29.2 bits, see alignment 4.5e-11 amino acids 642 to 727 (86 residues), 32.3 bits, see alignment E=5e-12 amino acids 748 to 808 (61 residues), 38.2 bits, see alignment 6.8e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_002873)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (879 amino acids)

>CSW01_07540 MCE family protein (Vibrio cholerae E7946 ATCC 55056)
MSQENTTQTSYTPEIRKRRGISPLWILPIVTMILAGWLVFKAVHDAGVRIQIHFENAQGL
IAGRTTIRYQGLEVGMVRDIKLSEGLDSIYVEADIYPEATKLLSNQTRFWMVKPTASLSG
VSGLDALVSGNYIAIQPGSTHQEDYPTQYQALDSAPSDLLAQRGLTISLKARDLGGISVG
SQIVYKKIPIGEVFSYQLDDDAQSVIIQASIKEEYQHIINTESRFWNVSGIGASIGFEGV
DVRLESLSALIGGSIAVDSPDEGKPVEQNAQFRLYRDLKTAGRGIAVSITLPDDNNISAS
GAPIMYRGIEIGQITDLQLTENRKSIVASAAIQPAFSDMLNQGSQFVLEEAQVSLTGVEN
LTNLVKGNYLTLIPGAGERTRNFQAVRKNEFKYARSNSISFNLVADNSFGLEAGTPILYR
GVAVGSVTAVNLKLDYVEFNVLIDEQYGALIRSQNRFYVTGSAAAELTESGLSVSIPPAK
QLLLGSISFASEGSSTPLEQYRLYSSQSLAELAKYNQSGSRSLTLFAHELPSINAGSPLL
YRNLKVGSISGFTLTPKGVQIEATIEKQYQHLLTPDTVFWNRSGVEIKASMDGVDVKAAP
LQTLIRGGIAFDNLPGIENKVGSMWKLYSDYDHARRYGEKITLTALGTLGVKVGTPVQYQ
GVQIGEVFEIIPDFESDFVKLAARIEPQYAPKIAKQNSQFWLSQAKIGLSGIENVQNLLG
QSIEVQPGNGESRFEFELHKEARHGGAGNTYTLQSEKRGSVSVGTPILYRDIEVGKVIDV
RLGEFADRVITTIRIAPQYTYLLRQNSVFWNVSGLDMSIGITGANVKAGTFDSMLRGGIT
FATPEQKQLTPAAPEGHTFYLYPQAQEEWTKWRTPIPKP