Protein Info for CSW01_07480 in Vibrio cholerae E7946 ATCC 55056

Annotation: ribosomal RNA large subunit methyltransferase K/L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 PF22020: RlmL_1st" amino acids 4 to 56 (53 residues), 57.5 bits, see alignment 5.3e-19 PF02926: THUMP" amino acids 71 to 153 (83 residues), 43.5 bits, see alignment E=1.8e-14 PF01170: UPF0020" amino acids 162 to 374 (213 residues), 200.1 bits, see alignment E=1.5e-62 PF10672: Methyltrans_SAM" amino acids 435 to 663 (229 residues), 81.7 bits, see alignment E=2.8e-26 PF03602: Cons_hypoth95" amino acids 540 to 665 (126 residues), 49 bits, see alignment E=2.9e-16

Best Hits

Swiss-Prot: 100% identical to RLMKL_VIBCH: Ribosomal RNA large subunit methyltransferase K/L (rlmL) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K12297, ribosomal RNA large subunit methyltransferase L [EC: 2.1.1.173] (inferred from 100% identity to vcm:VCM66_1431)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.173

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (708 amino acids)

>CSW01_07480 ribosomal RNA large subunit methyltransferase K/L (Vibrio cholerae E7946 ATCC 55056)
MNQYLAVTSNGLENLLVEELTQLGINDAKPVQAGVKFKATNEQIYRCCLWSRLASRFVRI
VAEFKCQNDLDLYLSTTSVNWVNYFHSSKKLVVDFNGTNREIRNSQYGAMKVKDAIVDCF
TKKNLPRPSISKDLADLHIHVRLHKENALLGIDMVGSGLHARGYRTEAGKAPLRETLAAA
IILRSGWDASKPLLDPMCGSGTLLIEAAMMAANIAPGLQRKKWGFEALEDFEPELWASVK
SEASVQGKRGVKKVETHFYGVDNDNRVLQTAKDNARRAGVEELISFTLGDAAKVKRPENF
AEGIVICNPPYGERLGTHPGLIALYTAFGAQLKAEFGGCHASIFSSSDELLSCLRMRADK
QFKLNNGALPCHQKNYTIAMREQNSVSNEGTQEILIAPDFANRLKKNFNKIGKWAKREGL
DCFRLYDADLPEYNVAIDVYQDHLMIQEYAAPKDIPEEKAKRRLTDIIRAAIQVLDVDAN
NVVLKVRERQKGTSQYEKLGQQAQTMQITEYGVKLIVNLYDYLDTGLFLDHKITRRRLGQ
MAQGKDFLNLFAYTGSATVHAACGGAKSTTTVDMSKTYLEWAKENMQLNGQVGRQHQYVQ
ADCLQWLANAQSQYDLIFIDPPTFSNSKRMEQTFDVQRDHVTLMTNLKRLLRPEGTIVFS
NNKRHFKMDMEALHALGLNAQNISHQTLPLDFERNKQIHNCWLITHQS