Protein Info for CSW01_07315 in Vibrio cholerae E7946 ATCC 55056

Annotation: Zona occludens toxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 227 to 245 (19 residues), see Phobius details PF05707: Zot" amino acids 2 to 211 (210 residues), 245.4 bits, see alignment E=1.7e-77

Best Hits

Swiss-Prot: 100% identical to ZOT_VIBCH: Zona occludens toxin (zot) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10954, zona occludens toxin (inferred from 100% identity to vch:VC1458)

Predicted SEED Role

"Zona occludens toxin" in subsystem Cholera toxin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>CSW01_07315 Zona occludens toxin (Vibrio cholerae E7946 ATCC 55056)
MSIFIHHGAPGSYKTSGALWLRLLPAIKSGRHIITNVRGLNLERMAKYLKMDVSDISIEF
IDTDHPDGRLTMARFWHWARKDAFLFIDECGRIWPPRLTVTNLKALDTPPDLVAEDRPES
FEVAFDMHRHHGWDICLTTPNIAKVHNMIREAAEIGYRHFNRATVGLGAKFTLTTHDAAN
SGQMDSHALTRQVKKIPSPIFKMYASTTTGKARDTMAGTALWKDRKILFLFGMVFLMFSY
SFYGLHDNPIFTGGNDATIESEQSEPQSKATVGNAVGSKAVAPASFGFCIGRLCVQDGFV
TVGDERYRLVDNLDIPYRGLWATGHHIYKDTLTVFFETESGSVPTELFASSYRYKVLPLP
DFNHFVVFDTFAAQALWVEVKRGLPIKTENDKKGLNSIF