Protein Info for CSW01_07310 in Vibrio cholerae E7946 ATCC 55056

Annotation: enterotoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01375: Enterotoxin_a" amino acids 3 to 258 (256 residues), 431.5 bits, see alignment E=1.3e-133 PF22596: Scabin-like" amino acids 23 to 161 (139 residues), 41.2 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 100% identical to CHTA_VIBCH: Cholera enterotoxin subunit A (ctxA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K10928, cholera enterotoxin subunit A [EC: 2.4.2.36] (inferred from 100% identity to vch:VC1457)

MetaCyc: 100% identical to cholera toxin, A subunit (Vibrio cholerae O1 biovar El Tor str. N16961)
NAD(+)--protein-arginine ADP-ribosyltransferase. [EC: 2.4.2.31]

Predicted SEED Role

"Enterotoxin, A subunit (NAD(+)--diphthamide ADP- ribosyltransferase) (EC 2.4.2.36)" in subsystem Cholera toxin (EC 2.4.2.36)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.31 or 2.4.2.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>CSW01_07310 enterotoxin (Vibrio cholerae E7946 ATCC 55056)
MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLY
DHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLG
AYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGY
GLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQI
FSGYQSDIDTHNRIKDEL