Protein Info for CSW01_07220 in Vibrio cholerae E7946 ATCC 55056

Annotation: CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05545: FixQ
  • amino acids 6 to 45 (40 residues), 54.2 bits, E=5.7e-19

Best Hits

KEGG orthology group: K00407, cb-type cytochrome c oxidase subunit IV [EC: 1.9.3.1] (inferred from 98% identity to vco:VC0395_A1051)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoQ (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Protein Sequence (54 amino acids)

>CSW01_07220 CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone (Vibrio cholerae E7946 ATCC 55056)
MDIGTIHSIWTIVLFICFIGVVWWAYGKKRKARFDEAANLIFADEEQNTSKNKE