Protein Info for CSW01_07195 in Vibrio cholerae E7946 ATCC 55056

Annotation: cytochrome biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details PF13386: DsbD_2" amino acids 8 to 210 (203 residues), 191 bits, see alignment E=1.2e-60

Best Hits

KEGG orthology group: K09792, hypothetical protein (inferred from 100% identity to vcj:VCD_002911)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>CSW01_07195 cytochrome biogenesis protein (Vibrio cholerae E7946 ATCC 55056)
MSPDYLGAWVVGLLGAGHCLGMCGGISALLTLDPSKSSPALLLYYNLGRLLSYALIGGIV
GGITASLTELIDVQSALVWLRIFAAVLMIVLGLYIGRWWFGLLWLEKVGQKIWRWISPLG
KTLLPLKKQWHALPFGLVWGWLPCGLVYSMLTWSAVAGSFSQGALIMLSFGFGTLPAMLA
SGWGANKLMHWQNSHLFRQCAAILVIGYGLFTAYDAVKLMINLG