Protein Info for CSW01_07150 in Vibrio cholerae E7946 ATCC 55056

Annotation: spermidine/putrescine ABC transporter permease PotC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 74 to 250 (177 residues), 65.7 bits, see alignment E=2.3e-22

Best Hits

Swiss-Prot: 75% identical to POTC_ECO57: Spermidine/putrescine transport system permease protein PotC (potC) from Escherichia coli O157:H7

KEGG orthology group: K11070, spermidine/putrescine transport system permease protein (inferred from 100% identity to vcj:VCD_002920)

MetaCyc: 75% identical to spermidine preferential ABC transporter membrane subunit PotC (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>CSW01_07150 spermidine/putrescine ABC transporter permease PotC (Vibrio cholerae E7946 ATCC 55056)
MGRSIRFSFMSLVYLFLYLPIIVLIANSFNENKFGIKWGGFTTKWYHALMNNDSLMQAAW
HSINVAVFSATAATLIGSLTAVALFRYQFKGKKVVSGMLFVVMMSPDIVMAISLLALFLV
MGAKLGFFTLLIAHITFCLPFVVVTVYTRLNGFDVKMLEAAKDLGAGEWVILKKIILPLA
KPAVAAGWLLSFTLSLDDVIISSFVTGPTYEILPLKIYSMVKVGISPEVNALATVMLVVS
LVLVVASQLLAREKVK