Protein Info for CSW01_07125 in Vibrio cholerae E7946 ATCC 55056

Annotation: sodium:alanine symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 16 to 443 (428 residues), 517.1 bits, see alignment E=1.8e-159 PF01235: Na_Ala_symp" amino acids 54 to 449 (396 residues), 459.6 bits, see alignment E=5.6e-142

Best Hits

Swiss-Prot: 61% identical to Y883_HAEIN: Uncharacterized transporter HI_0883 (HI_0883) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to vcm:VCM66_1377)

Predicted SEED Role

"Sodium/glycine symporter GlyP" in subsystem Glycine cleavage system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>CSW01_07125 sodium:alanine symporter family protein (Vibrio cholerae E7946 ATCC 55056)
MNNLQSFLQTVDSLVWGPPLLILLVGTGVYFTFRLGLLQFRRLPTALAMVFGREKSSDKQ
GDVSSFAALCTALSATIGTGNIVGVATAIKLGGPGALFWMWLAALFGMATKYAECLLAVK
YRQIDDKGQMVGGPMYYLRDGVSSKTLAVLFAVFAVGVACFGIGTFPQVNAILDATQISF
GVPREASAVVLTVLVAIVTIGGIQSIAKVAGKVVPAMALFYIIACLSVIVTNADKLADAV
ELVLVSAFTSTAATGGFLGASIMLAIQSGIARGVFSNESGLGSAPMAAAAAKTDSCVEQG
LISMTGTFFDTIIICTMTGLALILTGAWQSDLSGAAMTTYAFATGLNAQTIGPMLVSIGL
MFFAFTTILGWNYYGERCMVFLFGTKAVLPYKIVFIGLIASGAFLHLDLIWIIADIVNGL
MAIPNLIGLVALRHVVVEETKQYFAARYQYSEAEAQVQ