Protein Info for CSW01_07050 in Vibrio cholerae E7946 ATCC 55056

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 TIGR00229: PAS domain S-box protein" amino acids 36 to 143 (108 residues), 61.4 bits, see alignment E=4.8e-21 amino acids 156 to 260 (105 residues), 51.9 bits, see alignment E=4e-18 PF08448: PAS_4" amino acids 39 to 140 (102 residues), 47.3 bits, see alignment E=6.8e-16 amino acids 159 to 260 (102 residues), 39.4 bits, see alignment E=1.9e-13 PF00989: PAS" amino acids 41 to 137 (97 residues), 42.5 bits, see alignment E=1.8e-14 amino acids 158 to 257 (100 residues), 30.1 bits, see alignment E=1.3e-10 PF13426: PAS_9" amino acids 42 to 139 (98 residues), 47.7 bits, see alignment E=5.1e-16 amino acids 163 to 259 (97 residues), 40.5 bits, see alignment E=8.8e-14 PF08447: PAS_3" amino acids 48 to 134 (87 residues), 51.6 bits, see alignment E=2.7e-17 amino acids 171 to 253 (83 residues), 37.3 bits, see alignment E=8.2e-13 PF00015: MCPsignal" amino acids 293 to 435 (143 residues), 122.6 bits, see alignment E=4.9e-39

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to vcm:VCM66_1361)

Predicted SEED Role

"methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>CSW01_07050 hypothetical protein (Vibrio cholerae E7946 ATCC 55056)
MIWKPFMPFWKKAAAQSEVEQHNHDSDIVSALKRNLAYIEFDPQGKILDANALFLSAMGY
TKEEVIGQHHKIFCDPETVNSLEYAQFWKSLAQGQAQRKMFHRLKKDGSSIWIEATYMPV
RNRAGDVYKVIKVAHDVTKAKITADKQAAVFHSLDRSSAMIQFNPDGTIKEANENFLKAT
GYRLEEIVGKHHRMFCDDRFYKENPNFWRELARGEFKSGLFHRRTRHGQDLWLEATYNPI
FNDAGVVTQVVKFASDVTDQVLKAHATKEASQMAQQTSAETVRVAESGREMIDAAATIAS
GITESIAGANALMTDLSSQSQRITQIVTTINKIAEQTNLLALNAAIEAARAGEYGRGFAV
VADEVRSLASNTSQATSEIDNIVKRNSQLTEQSGQTMEQIQAKVTEFNHMLQQTQSLIEQ
IQHAAENVQKTVSNIVDE