Protein Info for CSW01_06930 in Vibrio cholerae E7946 ATCC 55056

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details amino acids 37 to 38 (2 residues), see Phobius details transmembrane" amino acids 36 to 36 (1 residues), see Phobius details amino acids 39 to 39 (1 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details PF03924: CHASE" amino acids 86 to 275 (190 residues), 86.1 bits, see alignment E=2.7e-28 PF00990: GGDEF" amino acids 361 to 512 (152 residues), 118.7 bits, see alignment E=2.2e-38 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 361 to 516 (156 residues), 131.4 bits, see alignment E=1.3e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1331)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>CSW01_06930 sensor domain-containing diguanylate cyclase (Vibrio cholerae E7946 ATCC 55056)
MIDNIIRKKWMLKHVRVIVPLLVLLFSLLLTVFVVYTAYSLQLRHNRTLLENLADRQTMA
LQQFVDGDIHFIGSAANFFRSSTSDDWVRFHTFAEETLKGSQSLIALQWLVKVEPPQAET
FTARMQQRFPEFTLYTVPKTGEIKYGFGTDDQAKYVLSDIYPLNYDNRKLLGFYSERERF
KRILADIVVNRRPNVSDKVRLLQDGIDKSIVKDGMLVYHPVFSSEDDRSLLGVMVGVVRL
STYFEKLVQISVMEQDLDMRVIDTGFDSEDSPVLYQSPMWRADDEPKIERKLVLPNRDWV
LEFELHQPINHSEEWVLLGLGLGGVIISLLLSYIMRMQLEEKQRLTDMIEERTAELRYLV
EHDSLTNIYNRRFFSQHLCKMLDEKQSFTLISFDIDRFKQINDSYGHLAGDYALTHVVDV
VKKELVESDIFARFGGDEFAILSSVTDETALYTYLERIRKVVEAEPVMLNAETPLTLTIS
IGASINCEYSEPEILQSVDDQLYLSKSKGRNRVSIAQQCSKVESNYAFNSGRMFDFM