Protein Info for CSW01_06875 in Vibrio cholerae E7946 ATCC 55056

Annotation: 7-cyano-7-deazaguanine synthase QueC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06508: QueC
  • amino acids 3 to 212 (210 residues), 276.6 bits, E=1.2e-86
• TIGR00364: queuosine biosynthesis protein QueC
  • amino acids 4 to 205 (202 residues), 278 bits, E=1.9e-87

Best Hits

Swiss-Prot: 100% identical to QUEC_VIBC3: 7-cyano-7-deazaguanine synthase (queC) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 100% identity to vco:VC0395_A0980)

MetaCyc: 69% identical to 7-cyano-7-deazaguanine synthase (Escherichia coli K-12 substr. MG1655)
RXN-12093 [EC: 6.3.4.20]

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

• preQ₀ biosynthesis (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.20

Protein Sequence (231 amino acids)

>CSW01_06875 7-cyano-7-deazaguanine synthase QueC (Vibrio cholerae E7946 ATCC 55056)
MKKAVVVFSGGQDSTTCLVQALKEFDEVHAITFDYGQRHKLEIEVAQQLAKQLGVTAHKV
MDVSLLNELAISSLTRDDIPVSHELQANGLPNSFVPGRNILFLTLAGIYAYQIGATTVIT
GVCETDFSGYPDCRDEFVQAMNQALAKGMDLPLMIRTPLMWLNKAETWALADQLGALDLV
RHQTLTCYNGLIGDGCGECPACGLRQAGLKAYLDNRDLIMSALKSKQSAAH