Protein Info for CSW01_06870 in Vibrio cholerae E7946 ATCC 55056

Annotation: 7-carboxy-7-deazaguanine synthase QueE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR04322: putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE" amino acids 31 to 245 (215 residues), 370 bits, see alignment E=1.6e-115 PF13353: Fer4_12" amino acids 35 to 132 (98 residues), 24 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 62% identical to QUEE_ECOLI: 7-carboxy-7-deazaguanine synthase (queE) from Escherichia coli (strain K12)

KEGG orthology group: K10026, queuosine biosynthesis protein QueE (inferred from 100% identity to vco:VC0395_A0978)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>CSW01_06870 7-carboxy-7-deazaguanine synthase QueE (Vibrio cholerae E7946 ATCC 55056)
MTSIAISIMVCHLQLFIHVRSFILYRINEMFEIIQGEGVFTGVPAVFVRLQGCPVGCAWC
DTKQTWETLDSDQTSFSQILLKTNDAPTWCQATAQEVVQRYQAQGYQAKHIVITGGEPCI
YDLTELTQAFEAMGCRCQIETSGTYEVCATENTWVTVSPKVAMKGKLPILDSALQRANEI
KHPVATEKDIDNLDELLARAQVSAQTAIALQPISQKPRATELCIRTCIARNWRLSIQTHK
YLNIA