Protein Info for CSW01_06770 in Vibrio cholerae E7946 ATCC 55056

Annotation: peptidase M20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR01883: peptidase T-like protein" amino acids 8 to 367 (360 residues), 623.2 bits, see alignment E=6.4e-192 PF04389: Peptidase_M28" amino acids 58 to 151 (94 residues), 45.7 bits, see alignment E=1.3e-15 PF01546: Peptidase_M20" amino acids 72 to 365 (294 residues), 71.8 bits, see alignment E=1.6e-23 PF05343: Peptidase_M42" amino acids 106 to 165 (60 residues), 27.1 bits, see alignment E=4.2e-10 PF07687: M20_dimer" amino acids 185 to 273 (89 residues), 51 bits, see alignment E=2.6e-17

Best Hits

Swiss-Prot: 48% identical to YQJE_BACSU: Uncharacterized protein YqjE (yqjE) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_1298)

Predicted SEED Role

"Peptidase, M20A family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>CSW01_06770 peptidase M20 (Vibrio cholerae E7946 ATCC 55056)
MSLINTQRLVDHFLQLIQIDSESGNEKKIAETLAEQLGELGFTVHKLPVPAEVSNGFNLY
ARLEGTLNDSILFSCHMDTVKPGIGIEPVIEDGIIRSKGNTILGGDDKSGIAAILEAVRV
LRDSQQAHKTIEIAFTVHEEGGLKGSEHFDMSKVQAEKAIVLDTGGPIGTIVRAAPGQQK
IVALIKGKPAHAGLVPEDGISAIAVAADAITQMKLLRIDEETTANIGIVQGGQATNIVMP
ELKIVAEARSLNDAKLEAQVQHMIETFERAAEKHGATVEIESTRAYNAFKLEEDNAHIQA
IKASFETIGIEPKTKLSGGGSDANNFNAKGLTTVNLSTGMAKVHTTEEYIAIADMVKIAE
FVCAYTTA