Protein Info for CSW01_06580 in Vibrio cholerae E7946 ATCC 55056

Annotation: aminodeoxychorismate synthase component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF04715: Anth_synt_I_N" amino acids 25 to 155 (131 residues), 97.6 bits, see alignment E=7.6e-32 TIGR00553: aminodeoxychorismate synthase, component I" amino acids 110 to 450 (341 residues), 409.2 bits, see alignment E=6.2e-127 PF00425: Chorismate_bind" amino acids 196 to 448 (253 residues), 301.3 bits, see alignment E=6.3e-94

Best Hits

Swiss-Prot: 60% identical to PABB_ECOLI: Aminodeoxychorismate synthase component 1 (pabB) from Escherichia coli (strain K12)

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 100% identity to vch:VC1303)

MetaCyc: 60% identical to aminodeoxychorismate synthase subunit 1 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>CSW01_06580 aminodeoxychorismate synthase component 1 (Vibrio cholerae E7946 ATCC 55056)
MNNNQTLSIEHKKLTYHPDIAKQFFTSIEQQPWAMLLRSASTTHMDSRFDILVANPFATL
VTFGDETEIHAQNGVTLSREDPFALLADIQEQYLPQVTDESELPFVGGALGYFSYDLGRR
VEVLPSLAEQDIAMPDMAVGIYSWALVVDHQQHTAQLVGQNVEDAWGWLNQQEAIKPSEV
TDFALTSPWRSNMSYTAYQDKFARVQDYLRSGDCYQINLAQRFQAHYTGSEWQAYLKLEK
GNQAPFSAFLRLPQGAILSVSPERFLQVCDRVIETKPIKGTRPRHADKQQDALLKQDLVS
AEKDQAENLMIVDLLRNDIGRVAKPGSVHVPKLFDVESFPAVHHLVSTIRATLDEQYQAA
DLLRACFPGGSITGAPKVRAMEIIEELEPHRRSAYCGSIGYLSRHGKMDTSITIRTLVAY
QQQLYAWAGGGLVADSEGAAEYQETLDKLSRILPTLES