Protein Info for CSW01_06580 in Vibrio cholerae E7946 ATCC 55056

Annotation: aminodeoxychorismate synthase component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04715: Anth_synt_I_N
  • amino acids 25 to 155 (131 residues), 96.7 bits, E=1.6e-31
• TIGR00553: aminodeoxychorismate synthase, component I
  • amino acids 110 to 450 (341 residues), 409.2 bits, E=6.2e-127
• PF00425: Chorismate_bind
  • amino acids 196 to 448 (253 residues), 306.9 bits, E=1.3e-95

Best Hits

Swiss-Prot: 60% identical to PABB_ECOLI: Aminodeoxychorismate synthase component 1 (pabB) from Escherichia coli (strain K12)

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 100% identity to vch:VC1303)

MetaCyc: 60% identical to aminodeoxychorismate synthase subunit 1 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Protein Sequence (458 amino acids)

>CSW01_06580 aminodeoxychorismate synthase component 1 (Vibrio cholerae E7946 ATCC 55056)
MNNNQTLSIEHKKLTYHPDIAKQFFTSIEQQPWAMLLRSASTTHMDSRFDILVANPFATL
VTFGDETEIHAQNGVTLSREDPFALLADIQEQYLPQVTDESELPFVGGALGYFSYDLGRR
VEVLPSLAEQDIAMPDMAVGIYSWALVVDHQQHTAQLVGQNVEDAWGWLNQQEAIKPSEV
TDFALTSPWRSNMSYTAYQDKFARVQDYLRSGDCYQINLAQRFQAHYTGSEWQAYLKLEK
GNQAPFSAFLRLPQGAILSVSPERFLQVCDRVIETKPIKGTRPRHADKQQDALLKQDLVS
AEKDQAENLMIVDLLRNDIGRVAKPGSVHVPKLFDVESFPAVHHLVSTIRATLDEQYQAA
DLLRACFPGGSITGAPKVRAMEIIEELEPHRRSAYCGSIGYLSRHGKMDTSITIRTLVAY
QQQLYAWAGGGLVADSEGAAEYQETLDKLSRILPTLES